MMAA Recombinant Protein Antigen

Name MMAA Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86603PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MMAA Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC7A5P2
Sequence EMWDKMKDFQDLMLASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMAA. Source: E.coli Amino Acid Sequence: EMWDKMKDFQDLMLASGELTAKRRKQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFL
Supplier Page Shop