SLC6A14 Recombinant Protein Antigen

Name SLC6A14 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86521PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody SLC6A14 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC6A14
Sequence FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Description A recombinant protein antigen corresponding to SLC6A14
Supplier Page Shop