Emx1 Recombinant Protein Antigen

Name Emx1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86500PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody Emx1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EMX1
Sequence RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Description A recombinant protein antigen corresponding to EMX1
Supplier Page Shop