C1orf105 Recombinant Protein Antigen

Name C1orf105 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86381PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C1orf105 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C1orf105
Sequence QPRTMKIPDDPKASFENCMSYRMSLHQPKFQTTPEPFHDDIPTESIHYRLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKEP
Description A recombinant protein antigen corresponding to C1ORF105
Supplier Page Shop