MPZL3 Recombinant Protein Antigen

Name MPZL3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86368PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody MPZL3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MPZL3
Sequence VRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLS
Description A recombinant protein antigen corresponding to MPZL3
Supplier Page Shop