PSKH2 Recombinant Protein Antigen

Name PSKH2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86459PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody PSKH2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PSKH2
Sequence SGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNLMQRASPHSQSPGSAQSSKSHYSHKSR
Description A recombinant protein antigen corresponding to PSKH2
Supplier Page Shop