AKD1 Recombinant Protein Antigen

Name AKD1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89162PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody AKD1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene AK9
Sequence YCPVTYKDGNQRYEALVPGSINYALEYHNRIYICENKEKLQKFLRSPLKYWEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNA
Description A recombinant protein antigen corresponding to AKD1
Supplier Page Shop