ALDH3B2 Recombinant Protein Antigen

Name ALDH3B2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89148PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody ALDH3B2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ALDH3B2
Sequence SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Description A recombinant protein antigen corresponding to ALDH3B2
Supplier Page Shop