PARP4 Recombinant Protein Antigen

Name PARP4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89232PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody PARP4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PARP4
Sequence ALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEF
Description A recombinant protein antigen corresponding to PARP4
Supplier Page Shop