FABP7 Protein (AEP10002)

Name FABP7 Protein (AEP10002)
Supplier Aviva Systems Biology
Catalog AEP10002
Category Protein
Prices $199.00
Sizes 100 µg
Applications WB
Species Reactivities Human
Tag/Conjugation GST
SwissProt/Accession O15540
Gene FABP7
Sequence MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Description The protein encoded by this gene is a brain fatty acid binding protein
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.