RYR2 (2460 - 2495)

Name RYR2 (2460 - 2495)
Supplier AnaSpec, Inc.
Catalog AS-64769
Category Peptide
Prices $297.00
Sizes 1 mg
Purity % Peak Area By HPLC ≥ 95%
Gene RYR2
Sequence GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Description This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Supplier Page Shop