Active human IGF2 protein fragment

Name Active human IGF2 protein fragment
Supplier Abcam
Catalog ab155617
Category Protein
Prices $302.00
Sizes 100 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Purity >95% by SDS-PAGE . Lyophilized from 0.22µm filtered solution
Bioactivity Measured in a serum-free cell proliferation assay using MCF7 Human breast cancer cells. The ED 50 for this effect is typically 2-10 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P01344
Gene IGF2
Residue 25 to 91
Sequence AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE
Supplier Page Shop

Product images