Active human IGF2 protein fragment
| Name | Active human IGF2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155617 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . Lyophilized from 0.22µm filtered solution |
| Bioactivity | Measured in a serum-free cell proliferation assay using MCF7 Human breast cancer cells. The ED 50 for this effect is typically 2-10 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01344 |
| Gene | IGF2 |
| Residue | 25 to 91 |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab155617 stained overnight with Coomassie Blue.