ATP5A1 Recombinant Protein (OPCA01476)

Name ATP5A1 Recombinant Protein (OPCA01476)
Supplier Aviva Systems Biology
Catalog OPCA01476
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P25705
Gene ATP5A1
Sequence QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE
Description This gene encodes a subunit of mitochondrial ATP synthase
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.