CLEC18A Recombinant Protein (OPCA01525)

Name CLEC18A Recombinant Protein (OPCA01525)
Supplier Aviva Systems Biology
Catalog OPCA01525
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession A5D8T8
Gene CLEC18A
Sequence EVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDWSDSLAQLAQARAALCGTPTPSLASGLWRTLQVGWNMQLLPAGLVSFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCV
Description This is one of three closely related paralogous genes on chromosome 16 encoding secreted proteins containing C-type lectin domains
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.