Name | CNTNAP1 Recombinant Protein (OPCA01533) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA01533 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | P78357 |
Gene | CNTNAP1 |
Sequence | DEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLD |
Description | The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex |
Supplier Page | Shop |