COL11A1 Recombinant Protein (OPCA01534)

Name COL11A1 Recombinant Protein (OPCA01534)
Supplier Aviva Systems Biology
Catalog OPCA01534
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation GST-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P12107
Gene COL11A1
Sequence GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Description This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.