| Name | DAOA Recombinant Protein (OPCA01555) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01555 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | GST-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P59103 |
| Gene | DAOA |
| Sequence | MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE |
| Description | This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors |
| Supplier Page | Shop |