DSG3 Recombinant Protein (OPCA01570)

Name DSG3 Recombinant Protein (OPCA01570)
Supplier Aviva Systems Biology
Catalog OPCA01570
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P32926
Gene DSG3
Sequence EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAV
Description This gene encodes a member of the desmoglein family and cadherin cell adhesion molecule superfamily of proteins
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.