Name | DSG3 Recombinant Protein (OPCA01570) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA01570 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | P32926 |
Gene | DSG3 |
Sequence | EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAV |
Description | This gene encodes a member of the desmoglein family and cadherin cell adhesion molecule superfamily of proteins |
Supplier Page | Shop |