GOSR2 Recombinant Protein (OPCA01622)

Name GOSR2 Recombinant Protein (OPCA01622)
Supplier Aviva Systems Biology
Catalog OPCA01622
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O14653
Gene GOSR2
Sequence MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
Description This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.