| Name | KCNJ10 Recombinant Protein (OPCA01673) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01673 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P78508 |
| Gene | KCNJ10 |
| Sequence | FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Description | This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell |
| Supplier Page | Shop |