Name | MRPL42 Recombinant Protein (OPCA01734) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA01734 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | GST-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | Q9Y6G3 |
Gene | MRPL42 |
Sequence | KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
Description | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion |
Supplier Page | Shop |