| Name | MRPL42 Recombinant Protein (OPCA01734) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01734 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | GST-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q9Y6G3 |
| Gene | MRPL42 |
| Sequence | KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
| Description | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion |
| Supplier Page | Shop |