| Name | NDUFB5 Recombinant Protein (OPCA01750) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01750 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O43674 |
| Gene | NDUFB5 |
| Sequence | GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
| Description | The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I) |
| Supplier Page | Shop |