NXF3 Recombinant Protein (OPCA01766)

Name NXF3 Recombinant Protein (OPCA01766)
Supplier Aviva Systems Biology
Catalog OPCA01766
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9H4D5
Gene NXF3
Sequence MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHE
Description This gene is one member of a family of nuclear RNA export factor genes
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.