PRSS23 Recombinant Protein (OPCA01802)

Name PRSS23 Recombinant Protein (OPCA01802)
Supplier Aviva Systems Biology
Catalog OPCA01802
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O95084
Gene PRSS23
Sequence QVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANDSTSAMPEQMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPG
Description This gene encodes a conserved member of the trypsin family of serine proteases
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.