| Name | RBP3 Recombinant Protein (OPCA01817) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01817 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Bovine |
| Tag/Conjugation | GST-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P10745 |
| Gene | RBP3 |
| Sequence | AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLY |
| Description | Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells |
| Supplier Page | Shop |