| Name | RS1 Recombinant Protein (OPCA01829) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01829 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O15537 |
| Gene | RS1 |
| Sequence | STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA |
| Description | This gene encodes an extracellular protein that plays a crucial role in the cellular organization of the retina |
| Supplier Page | Shop |