TBX18 Recombinant Protein (OPCA01886)

Name TBX18 Recombinant Protein (OPCA01886)
Supplier Aviva Systems Biology
Catalog OPCA01886
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O95935
Gene TBX18
Sequence MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQ
Description This genes codes for a member of an evolutionarily conserved family of transcription factors that plays a crucial role in embryonic development
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.