TM4SF4 Recombinant Protein (OPCA01900)

Name TM4SF4 Recombinant Protein (OPCA01900)
Supplier Aviva Systems Biology
Catalog OPCA01900
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P48230
Gene TM4SF4
Sequence MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
Description The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.