TRAF5 Recombinant Protein (OPCA01911)

Name TRAF5 Recombinant Protein (OPCA01911)
Supplier Aviva Systems Biology
Catalog OPCA01911
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O00463
Gene TRAF5
Sequence MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLE
Description The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.