| Name | YPEL1 Recombinant Protein (OPCA01932) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01932 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O60688 |
| Gene | YPEL1 |
| Sequence | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIDLAHMIKDNGWE |
| Description | This gene is located in the region associated with DiGeorge syndrome on chromosome 22 |
| Supplier Page | Shop |