CLVS2 Recombinant Protein (OPCA02291)

Name CLVS2 Recombinant Protein (OPCA02291)
Supplier Aviva Systems Biology
Catalog OPCA02291
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q5SYC1
Gene CLVS2
Sequence MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPP
Description This gene encodes a protein that belongs to the SEC14/CRAL-TRIO family of proteins
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.