CCBL Recombinant Protein (OPCA02314)

Name CCBL Recombinant Protein (OPCA02314)
Supplier Aviva Systems Biology
Catalog OPCA02314
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q6YP21
Gene CCBL2
Sequence MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYS
Description This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.