| Name | ITIH5 Recombinant Protein (OPCA02329) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02329 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q86UX2 |
| Gene | ITIH5 |
| Sequence | VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE |
| Description | This gene encodes a heavy chain component of one of the inter-alpha-trypsin inhibitor (ITI) family members |
| Supplier Page | Shop |