ST8SIA4 Recombinant Protein (OPCA02358)

• Supplier: Aviva Systems Biology
• Catalog: OPCA02358
• Category: Protein
• Prices: $250.00
• Sizes: 50 µg
• Nature: Recombinant
• Source: Human
• Tag/Conjugation: His-SUMO-tag
• Purity: Greater than 90% as determined by SDS-PAGE.
• SwissProt/Accession: Q92187
• Gene: ST8SIA4
• Sequence: KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
• Description: The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1)