DYDC2 Recombinant Protein (OPCA02374)

Name DYDC2 Recombinant Protein (OPCA02374)
Supplier Aviva Systems Biology
Catalog OPCA02374
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q96IM9
Gene DYDC2
Sequence METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
Description This gene encodes a member of a family of proteins that contains a DPY30 domain
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.