| Name | DEFB124 Recombinant Protein (OPCA02378) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02378 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q8NES8 |
| Gene | DEFB124 |
| Sequence | EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE |
| Description | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms |
| Supplier Page | Shop |