DCAF4 Recombinant Protein (OPCA02436)

Name DCAF4 Recombinant Protein (OPCA02436)
Supplier Aviva Systems Biology
Catalog OPCA02436
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q8WV16
Gene DCAF4
Sequence MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVTVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGC
Description This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.