VIPAS39 Recombinant Protein (OPCA02532)

Name VIPAS39 Recombinant Protein (OPCA02532)
Supplier Aviva Systems Biology
Catalog OPCA02532
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9H9C1
Gene VIPAS39
Sequence MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELAL
Description This gene encodes a protein involved in the sorting of lysosomal proteins
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.