| Name | TIMM10B Recombinant Protein (OPCA02555) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02555 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q9Y5J6 |
| Gene | TIMM10B |
| Sequence | MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS |
| Description | FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space |
| Supplier Page | Shop |