NOP58 Recombinant Protein (OPCA02561)

Name NOP58 Recombinant Protein (OPCA02561)
Supplier Aviva Systems Biology
Catalog OPCA02561
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9Y2X3
Gene NOP58
Sequence MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNIL
Description The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.