| Name | CALML5 Recombinant Protein (OPCA02570) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02570 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q9NZT1 |
| Gene | CALML5 |
| Sequence | AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE |
| Description | This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins |
| Supplier Page | Shop |