Name | CLTCL1 Recombinant Protein (OPCA02629) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA02629 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | P53675 |
Gene | CLTCL1 |
Sequence | LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF |
Description | This gene is a member of the clathrin heavy chain family and encodes a major protein of the polyhedral coat of coated pits and vesicles |
Supplier Page | Shop |