CLTCL1 Recombinant Protein (OPCA02629)

Name CLTCL1 Recombinant Protein (OPCA02629)
Supplier Aviva Systems Biology
Catalog OPCA02629
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P53675
Gene CLTCL1
Sequence LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Description This gene is a member of the clathrin heavy chain family and encodes a major protein of the polyhedral coat of coated pits and vesicles
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.