SLC34A2 Recombinant Protein (OPCA02796)

Name SLC34A2 Recombinant Protein (OPCA02796)
Supplier Aviva Systems Biology
Catalog OPCA02796
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O95436
Gene SLC34A2
Sequence LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Description The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.