TCN1 Recombinant Protein (OPCA02809)

Name TCN1 Recombinant Protein (OPCA02809)
Supplier Aviva Systems Biology
Catalog OPCA02809
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P20061
Gene TCN1
Sequence EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQ
Description This gene encodes a member of the vitamin B12-binding protein family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.