| Name | TSPAN7 Recombinant Protein (OPCA02822) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02822 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P41732 |
| Gene | TSPAN7 |
| Sequence | RHEIKDTFLRTYTDTMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM |
| Description | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family |
| Supplier Page | Shop |