Name | KIR2DS1 Recombinant Protein (OPCA03012) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA03012 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | Q14954 |
Gene | KIR2DS1 |
Sequence | HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH |
Description | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells |
Supplier Page | Shop |