CD300LF Recombinant Protein (OPCA03048)

Name CD300LF Recombinant Protein (OPCA03048)
Supplier Aviva Systems Biology
Catalog OPCA03048
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q8TDQ1
Gene CD300LF
Sequence TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Description This gene encodes a member of the CD300 protein family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.