| Name | KCNK2 Recombinant Protein (OPCA03278) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA03278 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O95069 |
| Gene | KCNK2 |
| Sequence | MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD |
| Description | This gene encodes one of the members of the two-pore-domain background potassium channel protein family |
| Supplier Page | Shop |