| Name | AGTR2 Recombinant Protein (OPCA03306) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA03306 |
| Category | Protein |
| Prices | $280.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P50052 |
| Gene | AGTR2 |
| Sequence | MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD |
| Description | The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary |
| Supplier Page | Shop |