PRSS12 Recombinant Protein (OPCA03356)

Name PRSS12 Recombinant Protein (OPCA03356)
Supplier Aviva Systems Biology
Catalog OPCA03356
Category Protein
Prices $365.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P56730
Gene PRSS12
Sequence IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
Description This gene encodes a member of the trypsin family of serine proteases
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.